Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Iga Monoclonal Laboratories manufactures the iga monoclonal protein reagents distributed by Genprice. The Iga Monoclonal Protein reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Protein
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Protein information
Anti-Mouse IgA, Rabbit Monoclonal Antibody |
A1787-50 |
Biovision |
each |
EUR 444 |
Rabbit Anti Human JUN Monoclonal Clone IGA-10 |
IRBAHUJUNIGA10C100UL |
Innovative research |
each |
EUR 496 |
|
Description: Rabbit Anti Human JUN Monoclonal Clone IGA-10 |
Mouse Anti-HDM IgA Monoclonal Antibody, Clone G4H9G12 |
7132 |
Chondrex |
1 mg/ml x 0.1 ml |
EUR 406.26 |
Description: Mouse Anti-HDM IgA Monoclonal Antibody |
Mouse Anti-Ovalbumin IgA Monoclonal Antibody, Clone 2G12E12 |
7090 |
Chondrex |
1 mg/ml x 0.1 ml |
EUR 406.26 |
Description: Mouse Anti-Ovalbumin IgA Monoclonal Antibody |
Anti-Human IgA (?1 & ?2) Rabbit Monoclonal Antibody |
A1796-50 |
Biovision |
each |
EUR 352.8 |
Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/764 |
AMM01637G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC |
Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/515 |
AMM01640G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC |
Rat Anti Mouse Iga Heavy Chain Monoclonal Antibody |
CABT-54649RM |
Creative Diagnostics |
0.25 mg |
EUR 651.6 |
Mouse Anti Rat Iga Heavy Chain Monoclonal Antibody |
DMABT-49899MR |
Creative Diagnostics |
0.25 mg |
EUR 651.6 |
Rabbit Anti-Human IgA monoclonal antibody, clone KN21-53 |
CABT-BL8591 |
Creative Diagnostics |
100 ul |
EUR 932.4 |
Mouse Anti Human Iga Heavy Chain Monoclonal Antibody |
CABT-48821MH |
Creative Diagnostics |
0.2 mg |
EUR 889.2 |
Anti-Human IgA Rabbit Monoclonal Antibody, Clone#RM128 |
M07514-1 |
BosterBio |
100ug |
EUR 450 |
Description: Anti-Human IgA Rabbit Monoclonal Antibody, Clone#RM128 tested in ICC, IHC, FC, ELISA, reactive to Human |
Anti-IgA Rabbit Monoclonal Antibody |
M07514 |
BosterBio |
100ug/vial |
EUR 476.4 |
Description: Rabbit Monoclonal IgA Antibody. Validated in IP, IF, WB and tested in Human. |
Mouse Anti Human Iga Secretory Chain Monoclonal Antibody |
CABT-48824MH |
Creative Diagnostics |
0.2 mg |
EUR 889.2 |
Mouse Anti Rat Iga Heavy Chain Monoclonal Antibody,FITC |
DMABT-49898MR |
Creative Diagnostics |
0.5 mg |
EUR 889.2 |
Monoclonal IgA Secretory Component / ECM1 Antibody, Clone: SC05 |
AMM00642G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in IHC, IF, FC |