L-NAME hydrochloride |
2356-100 |
Biovision |
each |
EUR 144 |
Iga Monoclonal Laboratories manufactures the .igakappa monoclonal protein reagents distributed by Genprice. The .Igakappa Monoclonal Protein reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other .Igakappa products are available in stock. Specificity: .Igakappa Category: Monoclonal Group: Protein
Monoclonal PP2A alpha and beta Antibody |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Protein information
TBP/TATA Binding Protein Monoclonal Antibody |
ABM40219-01ml |
Abbkine |
0.1ml |
EUR 346.8 |
|
Description: A monoclonal antibody for detection of TBP/TATA Binding Protein from Human, Mouse, Rat. This TBP/TATA Binding Protein antibody is for WB. It is affinity-purified from mouse ascites by affinity-chromatography using the specific immunogenand is unconjugated. The antibody is produced in mouse by using as an immunogen recombinant protein |
TBP/TATA Binding Protein Monoclonal Antibody |
ABM40219-02ml |
Abbkine |
0.2ml |
EUR 496.8 |
|
Description: A monoclonal antibody for detection of TBP/TATA Binding Protein from Human, Mouse, Rat. This TBP/TATA Binding Protein antibody is for WB. It is affinity-purified from mouse ascites by affinity-chromatography using the specific immunogenand is unconjugated. The antibody is produced in mouse by using as an immunogen recombinant protein |
TBP/TATA Binding Protein Monoclonal Antibody |
ABM40223-003ml |
Abbkine |
0.03ml |
EUR 189.6 |
|
Description: A monoclonal antibody for detection of TBP/TATA Binding Protein from Human, Mouse, Rat. This TBP/TATA Binding Protein antibody is for IHC-P. It is affinity-purified from mouse ascites by affinity-chromatography using the specific immunogenand is unconjugated. The antibody is produced in mouse by using as an immunogen recombinant protein |
TBP/TATA Binding Protein Monoclonal Antibody |
ABM40223-01ml |
Abbkine |
0.1ml |
EUR 346.8 |
|
Description: A monoclonal antibody for detection of TBP/TATA Binding Protein from Human, Mouse, Rat. This TBP/TATA Binding Protein antibody is for IHC-P. It is affinity-purified from mouse ascites by affinity-chromatography using the specific immunogenand is unconjugated. The antibody is produced in mouse by using as an immunogen recombinant protein |
TBP/TATA Binding Protein Monoclonal Antibody |
ABM40223-02ml |
Abbkine |
0.2ml |
EUR 496.8 |
|
Description: A monoclonal antibody for detection of TBP/TATA Binding Protein from Human, Mouse, Rat. This TBP/TATA Binding Protein antibody is for IHC-P. It is affinity-purified from mouse ascites by affinity-chromatography using the specific immunogenand is unconjugated. The antibody is produced in mouse by using as an immunogen recombinant protein |
TBP/TATA Binding Protein Monoclonal Antibody |
EM1216-100ul |
ELK Biotech |
100ul |
EUR 334.8 |
Description: A Mouse Monoclonal antibody against TBP/TATA Binding Protein from Human/ Rat/ Mouse. This antibody is tested and validated for WB, ELISA |
TBP/TATA Binding Protein Monoclonal Antibody |
EM1216-50ul |
ELK Biotech |
50ul |
EUR 248.4 |
Description: A Mouse Monoclonal antibody against TBP/TATA Binding Protein from Human/ Rat/ Mouse. This antibody is tested and validated for WB, ELISA |
TBP/TATA Binding Protein Monoclonal Antibody |
EM1220-100ul |
ELK Biotech |
100ul |
EUR 334.8 |
Description: A Mouse Monoclonal antibody against TBP/TATA Binding Protein from Human/ Rat/ Mouse. This antibody is tested and validated for IHC |
TBP/TATA Binding Protein Monoclonal Antibody |
EM1220-50ul |
ELK Biotech |
50ul |
EUR 248.4 |
Description: A Mouse Monoclonal antibody against TBP/TATA Binding Protein from Human/ Rat/ Mouse. This antibody is tested and validated for IHC |
Bcl-2-like protein 1 Monoclonal Antibody |
42016-100ul |
SAB |
100ul |
EUR 399.6 |
SARS-CoV-2 N Protein Monoclonal Antibody |
A73663 |
EpiGentek |
|
|
Mouse Monoclonal Anti-SARS Spike Protein IgG |
AB-15710 |
Alpha Diagnostics |
20 ug |
EUR 489.6 |
Tumor Protein p53 (TP53) Monoclonal Antibody (Rat) |
4-MAA928Ra21 |
Cloud-Clone |
-
EUR 302.40
-
EUR 3106.80
-
EUR 771.60
-
EUR 380.40
-
EUR 259.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Rat Tumor Protein p53 (TP53) |
Monoclonal Anti-Human Plasminogen protein IgG |
PLMN11-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Anti-Prion Protein Rabbit Monoclonal Antibody |
M02447 |
BosterBio |
100ug/vial |
EUR 476.4 |
Description: Rabbit Monoclonal Prion Protein Antibody. Validated in Flow Cytometry, IF, IHC, ICC, WB and tested in Human, Mouse, Rat. |
Monoclonal ABCA4 (Rim Protein) Antibody, Clone: 3F4 |
AMM05530G |
Leading Biology |
0.1ml |
EUR 633.6 |
Description: A Monoclonal antibody against Human ABCA4 (Rim Protein). The antibodies are raised in Mouse and are from clone 3F4. This antibody is applicable in IHC |
Major Basic Protein (MBP) Monoclonal Antibody (Rat) |
4-MAB650Ra21 |
Cloud-Clone |
-
EUR 312.00
-
EUR 3265.20
-
EUR 807.60
-
EUR 394.80
-
EUR 264.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Rat Major Basic Protein (MBP) |