Monoclonal antibody for SUR1 and SUR2B
SMC-432D	Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the igg monoclonal protein reagents distributed by Genprice. The Igg Monoclonal Protein reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Monoclonal Group: Protein

True Blue Chloride
Toronto Research Chemicals	100mg	EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural
Scientific Laboratory Supplies	PK10	EUR 129.6

True Blue Diaceturate Salt
Toronto Research Chemicals	100mg	EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt
Polysciences Europe GmbH	1mg	Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt
Polysciences Europe GmbH	5mg	Ask for price
Description: 108321-12-6

Dog True insulin ELISA kit
BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog True insulin ELISA kit
BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Protein information

Mouse Monoclonal Anti-human p16 protein IgG , aff pure
P161-M	Alpha Diagnostics	100 ug	EUR 578.4

Mouse Monoclonal Anti-mouse p16 protein IgG , aff pure
P162-M	Alpha Diagnostics	100 ug	EUR 578.4

Monoclonal Anti-human Topoisomerase I (TOP1) protein IgG
TOP11-M	Alpha Diagnostics	100 ug	EUR 578.4

Mouse monoclonal anti-human Thyroglobulin (Tg) protein IgG
THGL11-M	Alpha Diagnostics	100 ul	EUR 578.4

Monoclonal Anti-Human Progesterone Receptor protein (PR) IgG
PR11-M	Alpha Diagnostics	100 ul	EUR 578.4

Monoclonal Anti-Rubella virus core protein IgG, aff pure
RUBL16-M	Alpha Diagnostics	100 ug	EUR 489.6

Mouse Monoclonal Anti-Human AXL protein IgG-Biotinylated
AXL13-BTN	Alpha Diagnostics	100 ul	EUR 634.8

Rat monoclonal Anti-Mouse OBRb (EC) protein IgG, aff pure
OBR19-M	Alpha Diagnostics	100 ug	EUR 578.4

Mouse monoclonal Anti-Pig Citrate synthase (CS) protein IgG
CISY14-M	Alpha Diagnostics	100 ug	EUR 578.4

Monoclonal Anti-Rubella virus capsid protein IgG, aff pure
RUBL15-M	Alpha Diagnostics	100 ug	EUR 489.6

Anti-human IGF-Binding protein 2 IgG fraction (monoclonal)
MA-351-5	Austral Biologicals	100ug	EUR 425

Anti-human IGF-Binding protein 4 IgG fraction (monoclonal)
MA-361-5	Austral Biologicals	100ug	EUR 425

Anti-human IGF-Binding protein 5 IgG fraction (monoclonal)
MA-371-5	Austral Biologicals	100ug	EUR 425

Anti-human IGF-Binding protein 6 IgG fraction (monoclonal)
MA-381-5	Austral Biologicals	100ug	EUR 425

Anti-human Elongator Protein 1 (ELP1) IgG fraction (monoclonal)
TM-1701Y-55	Austral Biologicals	150ug	EUR 425

Mouse Monoclonal Anti-Dengue Virus Type 1 NS1 protein IgG
DV1NS14-M	Alpha Diagnostics	100 ul	EUR 578.4

Mouse Monoclonal Anti-Dengue Virus Type 2 NS1 protein IgG
DV2NS22-M	Alpha Diagnostics	100 ul	EUR 578.4