Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Ige Monoclonal Laboratories manufactures the ige monoclonal protein reagents distributed by Genprice. The Ige Monoclonal Protein reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Monoclonal Group: Protein
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 480 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Protein information
Mouse Anti Human Ige Monoclonal Antibody,HRP |
|
CABT-48842MH |
Creative Diagnostics |
0.1 mg |
EUR 540.54 |
|
|
|
Description: Mouse |
Mouse Anti Dog Ige Monoclonal Antibody,Biotin |
|
DMABT-48837MD |
Creative Diagnostics |
0.25 mg |
EUR 667.8 |
|
|
|
Description: Mouse |
Mouse Anti Rat Ige Monoclonal Antibody,Biotin |
|
CABT-49902MR |
Creative Diagnostics |
0.5 mg |
EUR 546 |
|
|
|
Description: Mouse |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), PE |
|
4-MAA545Po21-PE |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with PE. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC |
|
4-MAA545Po21-APC |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Cy3 |
|
4-MAA545Po21-Cy3 |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Cy3. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), HRP |
|
4-MAA545Po21-HRP |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with HRP. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), FITC |
|
4-MAA545Po21-FITC |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with FITC. |
Mouse Monoclonal anti-Human IgE Antibody |
|
xAP-0403 |
Angio Proteomie |
100ug |
EUR 280 |
Anti-Human IgE, Rabbit Monoclonal Antibody |
|
A1800-50 |
Biovision |
each |
EUR 392.4 |
Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MAA545Po21 |
Cloud-Clone |
100ul |
EUR 279 |
|
|
Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MAA545Po22 |
Cloud-Clone |
100ul |
EUR 282 |
|
|
Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2111153-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Monoclonal mouse anti-human IgE, in vitro |
|
MBS660283-10mg |
MyBiosource |
10mg |
EUR 2885 |
Monoclonal mouse anti-human IgE, in vitro |
|
MBS660283-15mg |
MyBiosource |
15mg |
EUR 4055 |
Monoclonal mouse anti-human IgE, in vitro |
|
MBS660283-1mg |
MyBiosource |
1mg |
EUR 460 |
Monoclonal mouse anti-human IgE, in vitro |
|
MBS660283-25mg |
MyBiosource |
25mg |
EUR 6400 |
