Ige Monoclonal Protein

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Ige Monoclonal Laboratories manufactures the ige monoclonal protein reagents distributed by Genprice. The Ige Monoclonal Protein reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Monoclonal Group: Protein

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

Monoclonal PP2A alpha and beta Antibody

0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Protein information

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), PE

4-MAA545Po21-PE
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with PE.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC

4-MAA545Po21-APC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Cy3

4-MAA545Po21-Cy3
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Cy3.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), HRP

4-MAA545Po21-HRP
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with HRP.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), FITC

4-MAA545Po21-FITC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with FITC.

Mouse Monoclonal anti-Human IgE Antibody

xAP-0403 100ug
EUR 280

Anti-Human IgE, Rabbit Monoclonal Antibody

A1800-50 each
EUR 392.4

Monoclonal Antibody to Immunoglobulin E (IgE)

MAA545Po21 100ul
EUR 279

Monoclonal Antibody to Immunoglobulin E (IgE)

MAA545Po22 100ul
EUR 282

Rabbit Anti Human IGF2 Monoclonal Clone IGE-9

IRBAHUIGF2IGE9C100UL each
EUR 496
Description: Rabbit Anti Human IGF2 Monoclonal Clone IGE-9

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Biotinylated

4-MAA545Po21-Biotin
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Biotin.

Mouse Anti Horse IgE Monoclonal Clone 3A1 Lyophilized

IMSAHSIGE3A1C500UG each
EUR 1147
Description: Mouse Anti Horse IgE Monoclonal Clone 3A1 Lyophilized

Mouse Anti Horse IgE Monoclonal Clone 3E6 Lyophilized

IMSAHSIGE3E6C500UG each
EUR 1147
Description: Mouse Anti Horse IgE Monoclonal Clone 3E6 Lyophilized

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC-Cy7

4-MAA545Po21-APC-Cy7
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC-Cy7.

Human IgE mouse monoclonal antibody, clone 4H10

1E4-4H10 1 mg Ask for price

Mouse Monoclonal Anti-Cat IgE-HRP conjugate

71050-HP 0.5 ml
EUR 343.2

Mouse Anti Human IgE Monoclonal Clone 24A HRP Labeled

IMSAHUIGE24ACHRP1MG each
EUR 428
Description: Mouse Anti Human IgE Monoclonal Clone 24A HRP Labeled